PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C005569P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 259aa    MW: 29410.9 Da    PI: 5.9712
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C005569P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.42.2e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT++Ed++l++ +   G  +W+++++  g++R++k+c++rw +yl
   MELO3C005569P1 14 KGPWTADEDKKLINFILTNGQCCWRAVPKLAGLRRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding52.51.1e-1670111447
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       T  E++l +d++++lG++ W++Ia++++ gRt++++k++w+++
   MELO3C005569P1  70 LTDTEEQLVIDLHARLGNR-WSKIAARLP-GRTDNEIKNHWNTH 111
                      5999***************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.7E-21562IPR009057Homeodomain-like
PROSITE profilePS5129413.436961IPR017930Myb domain
SuperFamilySSF466892.45E-2611108IPR009057Homeodomain-like
SMARTSM007173.3E-121363IPR001005SANT/Myb domain
PfamPF002492.4E-141461IPR001005SANT/Myb domain
CDDcd001673.51E-81661No hitNo description
PROSITE profilePS5129427.45962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.7E-2563117IPR009057Homeodomain-like
SMARTSM007171.2E-1466114IPR001005SANT/Myb domain
PfamPF002497.5E-1570111IPR001005SANT/Myb domain
CDDcd001671.12E-1071112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MGRQPCCDKL GVKKGPWTAD EDKKLINFIL TNGQCCWRAV PKLAGLRRCG KSCRLRWTNY  60
LRPDLKRGLL TDTEEQLVID LHARLGNRWS KIAARLPGRT DNEIKNHWNT HIKKKLIKMG  120
IDPVTHEPIQ KQPENEKNQS SSTKTENNTV LDSSSSPPMM ENSSSVTTDE SSFLLDNNLS  180
SSNNNNESSF ITNTSFWIDE EALWNNSPPI SNGANFLWEE NCSWLLDCED FGIHDFGFDC  240
FNDFEIKAIN TTEMEGKH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-28141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818950.0LN681895.1 Cucumis melo genomic scaffold, anchoredscaffold00005.
GenBankLN7132630.0LN713263.1 Cucumis melo genomic chromosome, chr_9.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008437136.10.0PREDICTED: protein ODORANT1-like
SwissprotQ50EX61e-100ODO1_PETHY; Protein ODORANT1
TrEMBLA0A0A0KMT40.0A0A0A0KMT4_CUCSA; Uncharacterized protein
STRINGGLYMA01G42050.11e-113(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65334142
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G22680.14e-88myb domain protein 85